DPCfam | MC491270
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 101 ± 14 aa |
| Residues in low-complexity regions (%) | 4.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.92 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF07901 |
| Sequences matching dominant architecture (%) | 96.97 |
| Average overlap percent | 28.83 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4QIT5 | 2-92 | 91 | RRLCLAMCMAVSVMSLGGCLSMFGEISEEEHAERTLMSVNEYTGEEYRLRGGQATNDLAQELFPDIEEAVQAFFREEYKTDVIVH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FYE2-F1 | 4-98 | 97.96 | 80.40 | View in AlphaFoldDB ↗ |