DPCfam | MC491262
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 60 ± 1 aa |
| Residues in low-complexity regions (%) | 1.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01843 |
| Sequences matching dominant architecture (%) | 1.67 |
| Average overlap percent | 39.72 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000581650E | 726-786 | 61 | RVMEQLVNRLDVAMFNAILRESAKDMPTDPVSDPICDSNVLPVPAGKSSFGAGAQLKNVIG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9SLC7-F1 | 418-477 | 100.00 | 90.75 | View in AlphaFoldDB ↗ |