DPCfam | MC490253
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Residues in low-complexity regions (%) | 1.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.71 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF09612 |
| Sequences matching dominant architecture (%) | 98.04 |
| Average overlap percent | 39.07 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I7VXL3 | 68-159 | 92 | FTLVTALLDIGRGDWWEYRRPLGSYYGFLENLLKLKVNLIIFVDQKSVKHVYTQRKLYRLDHITMIIPINLAELPLYRYMKTAME... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2K6W982-F1 | 422-504 | 96.59 | 96.88 | View in AlphaFoldDB ↗ |