DPCfam | MC490207
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 59 ± 14 aa |
| Residues in low-complexity regions (%) | 3.98 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.14 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182JVJ0 | 166-234 | 69 | AEMVFDSDEDSDGHGGYSHGKLSNERKNVVEFLNTAGLNELICVKTLSMKKIDLLLEQRPFKDWSNLVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8Q445-F1 | 310-380 | 97.22 | 78.82 | View in AlphaFoldDB ↗ |