DPCfam | MC490187
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 361 |
|---|---|
| Mean domain length (aa) | 211 ± 32 aa |
| Residues in low-complexity regions (%) | 3.42 |
| Residues in coiled-coil regions (%) | 4.63 |
| Predicted disordered residues (%) | 15.45 |
| Average transmembrane regions | 0.32 |
| Dominant Pfam architecture(s) | PF10300 |
| Sequences matching dominant architecture (%) | 95.77 |
| Average overlap percent | 56.19 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009B33135 | 28-238 | 211 | CQMDLQTAIQETQCALSLVLNNKLSESLDLLKPWWRDSIYHAMAYSSILMIQATMTFEHRDIQTAMVIIKEALNTCQRFRKRNSM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q28D40-F1 | 17-221 | 99.52 | 89.19 | View in AlphaFoldDB ↗ |