DPCfam | MC490183
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Residues in low-complexity regions (%) | 0.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.84 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03098 |
| Sequences matching dominant architecture (%) | 57.3 |
| Average overlap percent | 7.68 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F9XMQ7 | 41-123 | 83 | SFVSALLTEGVTDDRKYLLENLIKWAASYPKDSPTGALLTNTMLATLWDNLKHPPLSYLGDQWRYRTADGSHNNILYPDLGKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4WY82-F1 | 110-190 | 100.00 | 84.38 | View in AlphaFoldDB ↗ |