DPCfam | MC489899
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 215 ± 21 aa |
| Residues in low-complexity regions (%) | 2.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.33 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J3NWC9 | 238-451 | 214 | NPLFALPLVRGESVLHSGTDPVAGFHLATAFAPLMPGSPVRMDSAARHSIPKSKWAMQELFREWTQALQETISHGRFVVRLVSTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2G7X3-F1 | 235-443 | 97.66 | 91.15 | View in AlphaFoldDB ↗ |