DPCfam | MC489864
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 313 ± 42 aa |
| Residues in low-complexity regions (%) | 7.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 48.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04433 |
| Sequences matching dominant architecture (%) | 98.73 |
| Average overlap percent | 23.26 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q0V2K9 | 71-378 | 307 | HAYASPPISPYETQSQKENMEVVDEQGAVDPQLFASSSNSAPVALEPLFPQEPASQTISKHMQSPSYARLQTRPSLEDYELAVTF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W3W8-F1 | 92-417 | 98.14 | 73.51 | View in AlphaFoldDB ↗ |