DPCfam | MC489703
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 544 ± 50 aa |
| Residues in low-complexity regions (%) | 2.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.79 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05345 |
| Sequences matching dominant architecture (%) | 1.49 |
| Average overlap percent | 1.59 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M6N939 | 66-624 | 559 | VVLGQAFRMGDLPRGASLGARLPDARRIAAQADIMSRHPDGSARFAVVALALPMPGRGERIGVVLSREEGAAAPPLDAKAALAGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31530-F1 | 17-99 | 16.32 | 91.53 | View in AlphaFoldDB ↗ |