DPCfam | MC489511
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Residues in low-complexity regions (%) | 2.49 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q7NH43 | 7-93 | 86 | ADRVDSKETFLEFVGALRADWETSRAEESAQPSSPCSPAARGWENPDLGRFLGALHAWTEDMGDRVAPQPSWRTFADMLMAAKIY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I2H5-F1 | 9-98 | 98.73 | 95.41 | View in AlphaFoldDB ↗ |