DPCfam | MC489359
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 601 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Residues in low-complexity regions (%) | 1.06 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14305 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 31.63 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C9A6W6 | 34-128 | 95 | LGYKINFSNPQTYNEKIQWLKLYWYDEKAKTCVDKFLVRDYVEKKGYKDILNELYGVYNNFDDINFDVLPNSYVLKATHNSGDVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0P8H6-F1 | 463-597 | 97.09 | 91.09 | View in AlphaFoldDB ↗ |