DPCfam | MC489295
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 81 ± 11 aa |
| Residues in low-complexity regions (%) | 2.52 |
| Residues in coiled-coil regions (%) | 0.77 |
| Predicted disordered residues (%) | 13.46 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08617 |
| Sequences matching dominant architecture (%) | 95.0 |
| Average overlap percent | 62.89 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A133UD48 | 44-121 | 78 | QIFNARRIAGKQHLVHASKLALEAWEKGKSFANSLRIELTCWTAALRQIDKAIDRVGVKENSKEFASLTVGKNKTKVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q57646-F1 | 17-85 | 88.24 | 95.22 | View in AlphaFoldDB ↗ |