DPCfam | MC489278
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 187 ± 27 aa |
| Residues in low-complexity regions (%) | 1.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10096 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 66.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A023NRH5 | 303-507 | 205 | IMHGYTHQYSNVANPYSGVSADDFEFYRAHINSSNYVVYDTPVAEDSMSWTQGRIQKGLLEFSNAGFQAPTIFEPPHYAASAIDY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O31487-F1 | 279-484 | 98.30 | 95.38 | View in AlphaFoldDB ↗ |