DPCfam | MC489156
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 75 ± 11 aa |
| Residues in low-complexity regions (%) | 5.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.04 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF05129 |
| Sequences matching dominant architecture (%) | 96.28 |
| Average overlap percent | 90.27 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q9N6F2 | 3-79 | 77 | GRRKTRKIVVRPKPKVPTVFNCPACGKKAVRVVISKTEKTATVKCGSCKMELTIPSHALMEPVDAYGVFVDAFKKAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044QLX4-F1 | 1-82 | 100.00 | 88.50 | View in AlphaFoldDB ↗ |