DPCfam | MC489090
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Residues in low-complexity regions (%) | 4.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.31 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A074Q4G2 | 1-90 | 90 | MDLLKIALKLGPACPGELLLDCFELARDIRVLDMQASPYDVTGLGHATVAIETPAGRAEYVARQREFGERAAPLRNRLLEVTSAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EYD9-F1 | 201-286 | 98.85 | 98.00 | View in AlphaFoldDB ↗ |