DPCfam | MC488997
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 54 ± 8 aa |
| Residues in low-complexity regions (%) | 4.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.99 |
| Average transmembrane regions | 0.93 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C0HGN9 | 40-98 | 59 | FLLAAEQTQRKDPLDGLRYYTGGWNISDEHYWASVGFTAAPVFAAAAVWFVVFGIGLFI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q1PF01-F1 | 72-128 | 96.61 | 92.14 | View in AlphaFoldDB ↗ |