DPCfam | MC48889
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 194 ± 20 aa |
| Residues in low-complexity regions (%) | 2.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.86 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00640 |
| Sequences matching dominant architecture (%) | 14.81 |
| Average overlap percent | 37.43 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F1R309 | 22-226 | 205 | YRPTLVGSLAIHPQTTMAILPWVVAEIRRPGVREKNRNLEFNGNYSPEIRDQPVVLQISASSVCCILDTAGPGKPWNPLQHMVLF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O60343-F1 | 36-236 | 98.90 | 73.70 | View in AlphaFoldDB ↗ |