DPCfam | MC488851
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 417 ± 58 aa |
| Residues in low-complexity regions (%) | 13.8 |
| Residues in coiled-coil regions (%) | 0.21 |
| Predicted disordered residues (%) | 60.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15949 |
| Sequences matching dominant architecture (%) | 86.27 |
| Average overlap percent | 19.25 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K8VEH7 | 104-532 | 429 | TKARVTRPTPPPPSYNPMQFVQIKPCNLYQTAQEQLKKAEEVKKIKEIKKEEPEDWQNNLDNWKSSRRKRVEHIIDRVVEVKKLE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0KIC3-F1 | 50-491 | 99.77 | 54.65 | View in AlphaFoldDB ↗ |