DPCfam | MC488786
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 531 |
|---|---|
| Mean domain length (aa) | 199 ± 22 aa |
| Residues in low-complexity regions (%) | 7.78 |
| Residues in coiled-coil regions (%) | 0.45 |
| Predicted disordered residues (%) | 8.93 |
| Average transmembrane regions | 3.53 |
| Dominant Pfam architecture(s) | PF06570 |
| Sequences matching dominant architecture (%) | 44.81 |
| Average overlap percent | 83.16 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A178NZW3 | 5-169 | 165 | TKQLIDLNNKKREQLNEEDLEVYEDFLLYVRTDLRVSEHETEVILNDVLDHLLEATSNGRSAIEFFGHDVKGHADEILEELPNES... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132Z8Z5-F1 | 9-218 | 99.49 | 90.62 | View in AlphaFoldDB ↗ |