DPCfam | MC488681
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 424 ± 56 aa |
| Residues in low-complexity regions (%) | 4.56 |
| Residues in coiled-coil regions (%) | 0.36 |
| Predicted disordered residues (%) | 17.82 |
| Average transmembrane regions | 0.5 |
| Dominant Pfam architecture(s) | PF11635 |
| Sequences matching dominant architecture (%) | 89.77 |
| Average overlap percent | 58.15 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L0DP36 | 624-1013 | 390 | LIIESHRAINFQLNSFSKESVDKLLSNPPMQKLLSLQLAVSEHHTLNRAIRDLAWVVLNLRSTSFGIMFSLSSIYRQISKKKPVE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W220-F1 | 577-1062 | 98.51 | 83.48 | View in AlphaFoldDB ↗ |