DPCfam | MC488645
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 721 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Residues in low-complexity regions (%) | 1.12 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 31.23 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0I9XBL4 | 407-480 | 74 | PKNIEYPGGRHDNDFADITKIAILPTYGEVVSEQEEYLPSTNFTDPHVLDDPLQRHIDSMFRLVRHDILGPVKD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WBB2-F1 | 201-271 | 97.14 | 87.81 | View in AlphaFoldDB ↗ |