DPCfam | MC488380
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 206 ± 32 aa |
| Residues in low-complexity regions (%) | 2.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.25 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF12816 |
| Sequences matching dominant architecture (%) | 96.76 |
| Average overlap percent | 86.88 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L0C4R1 | 623-824 | 202 | VFFNTLENFILTKQIRNLSPVLFKHLVEFYVHSGDGGILTEIICILDTYTLNIDETLHLCDLHGLRECSVYIWNHLLHDYMTPFV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4A5F7-F1 | 454-664 | 100.00 | 84.72 | View in AlphaFoldDB ↗ |