DPCfam | MC488013
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Residues in low-complexity regions (%) | 3.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G4STC1 | 23-94 | 72 | MNASIQEVKNKHQPELLQLPGVVSVGIGLDEEGRQAIIVGLAEDNRNDKVRIPETIEGYSVKVQVVGTIKAQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6Z9X3-F1 | 117-173 | 68.42 | 91.52 | View in AlphaFoldDB ↗ |