DPCfam | MC487906
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Residues in low-complexity regions (%) | 3.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.42 |
| Average transmembrane regions | 3.07 |
| Dominant Pfam architecture(s) | PF01757 |
| Sequences matching dominant architecture (%) | 87.5 |
| Average overlap percent | 34.43 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0003B58805 | 281-371 | 91 | PVVMGHYWFATAYIIMYIFSPFLTKAMRMMDQRTHRKLIFLLLIPLCFAKSIIPYDVTLDDLGTSFVWFLVLFIIAGYIRIYGIK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5P3G084-F1 | 86-181 | 94.34 | 86.43 | View in AlphaFoldDB ↗ |