DPCfam | MC48766
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 149 ± 17 aa |
| Residues in low-complexity regions (%) | 1.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18132 |
| Sequences matching dominant architecture (%) | 99.35 |
| Average overlap percent | 81.75 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B2VW57 | 386-532 | 147 | QATDWLCQVNLPTDIKISYSVRAFLGEPSTNPVDWPTDPNYVGQIASMSSPRMSSSVVTTGNIVLTEKLAQKHASGELKSLDKET... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P00440-F1 | 518-663 | 98.65 | 91.74 | View in AlphaFoldDB ↗ |