DPCfam | MC487357
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1501 |
|---|---|
| Mean domain length (aa) | 170 ± 22 aa |
| Residues in low-complexity regions (%) | 10.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.1 |
| Average transmembrane regions | 4.25 |
| Dominant Pfam architecture(s) | PF02660 |
| Sequences matching dominant architecture (%) | 99.63 |
| Average overlap percent | 91.97 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000981DC72 | 1-168 | 168 | MKNSGVKNPGASNTVLVLGWKYGVMVALIDILKAVFPIVIFGLLLRMEGMELGLIRMIQYIIGSFVIIGHNFPFQMKFLGGKGTA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8R9J2-F1 | 6-178 | 99.36 | 97.47 | View in AlphaFoldDB ↗ |