DPCfam | MC487131
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 371 |
|---|---|
| Mean domain length (aa) | 221 ± 30 aa |
| Residues in low-complexity regions (%) | 4.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.17 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13385 |
| Sequences matching dominant architecture (%) | 1.45 |
| Average overlap percent | 5.1 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E3G6R7 | 2345-2556 | 212 | TNFFTNPEAFAVNWQANSNGGVDSLLIADNSIAAPDGTVTAEKFFAQNSNGGVHDTFRDYSLTAFETFDSGSVKFDTSNETFDTG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-M0R3V4-F1 | 8-127 | 52.59 | 89.36 | View in AlphaFoldDB ↗ |