DPCfam | MC486741
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 391 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Residues in low-complexity regions (%) | 2.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02700 |
| Sequences matching dominant architecture (%) | 95.26 |
| Average overlap percent | 96.43 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B2I4J3 | 5-81 | 77 | AEAVITPREGVLDTQGKAVEKTLTHLGYEGLSEVRVGRIVTMRLEAKDGDAAAEAVKNMCQDLLANDLIETYKISVR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P12049-F1 | 3-78 | 100.00 | 97.66 | View in AlphaFoldDB ↗ |