DPCfam | MC486727
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 310 ± 23 aa |
| Residues in low-complexity regions (%) | 3.59 |
| Residues in coiled-coil regions (%) | 0.06 |
| Predicted disordered residues (%) | 32.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00432- PF00432 |
| Sequences matching dominant architecture (%) | 18.64 |
| Average overlap percent | 35.57 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q7HFM6 | 37-383 | 347 | HAPTARAASPSWNARAAAAYLDGRQAWWQQWPNAARDHDTACVSCHTALPYALARPALRRALGEQDLAAPERTMITNVVKRVKLW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P33247-F1 | 378-487 | 29.57 | 98.32 | View in AlphaFoldDB ↗ |