DPCfam | MC486699
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 588 ± 74 aa |
| Residues in low-complexity regions (%) | 2.7 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 31.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03787 |
| Sequences matching dominant architecture (%) | 85.0 |
| Average overlap percent | 80.76 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U1LME5 | 4-548 | 545 | VHAPYHFVPLSKWVYMPDWAHLVSHDVPFENGLSGTIDYTLVNQTPLCVGQEHVKQDNAPTGVKWTKDPQGNPIIPGSSIKGMLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59063-F1 | 16-64 | 8.61 | 85.48 | View in AlphaFoldDB ↗ |