DPCfam | MC486311
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 276 ± 36 aa |
| Residues in low-complexity regions (%) | 7.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.93 |
| Average transmembrane regions | 0.2 |
| Dominant Pfam architecture(s) | PF15489 |
| Sequences matching dominant architecture (%) | 91.67 |
| Average overlap percent | 34.47 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DAFC0E | 72-357 | 286 | ERAWLKNLFLFIGRYLSPCFRDPAPSNAEDSLTGVEQFSIRVVQEIQQRSSVTHCLPVSYRTLSISELVSQQKLACVSNFSWTTN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0JMF1-F1 | 10-307 | 99.34 | 83.20 | View in AlphaFoldDB ↗ |