DPCfam | MC485922
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 951 |
|---|---|
| Mean domain length (aa) | 234 ± 33 aa |
| Residues in low-complexity regions (%) | 4.88 |
| Residues in coiled-coil regions (%) | 0.31 |
| Predicted disordered residues (%) | 9.57 |
| Average transmembrane regions | 2.57 |
| Dominant Pfam architecture(s) | PF13967- PF14703 |
| Sequences matching dominant architecture (%) | 82.05 |
| Average overlap percent | 69.24 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J9XDA9 | 52-279 | 228 | RPRNNIVYAPKNKYPESQGKKPEPLGKHPFSWMLSVFRMSDDRLVDFIGIDAVLYIKFMTMLRNIFLVLAVLGCLVMIPINVTYN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GR89-F1 | 33-282 | 100.00 | 86.46 | View in AlphaFoldDB ↗ |