DPCfam | MC485817
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 134 ± 29 aa |
| Residues in low-complexity regions (%) | 5.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.49 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF11816 |
| Sequences matching dominant architecture (%) | 95.0 |
| Average overlap percent | 79.1 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K4CJS4 | 7-100 | 94 | DFVLQVINYVVEKLVLDKPLDSVNSDGTFAPGLHGTTGVDDSSRIGPKPSQKHKPSIEILCNNQVLSPEMSLATVRAYIWKKPED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F3K4-F1 | 543-674 | 99.28 | 82.19 | View in AlphaFoldDB ↗ |