DPCfam | MC485742
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 51 ± 5 aa |
| Residues in low-complexity regions (%) | 0.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.99 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04113 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 18.22 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F2QT35 | 176-235 | 60 | LFLFRSALPREPVCTENLTPFLDLLPSKGKNGLSSLLNGHKVYDSQWNSMSIDVETNCDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B0G182-F1 | 221-277 | 98.28 | 92.23 | View in AlphaFoldDB ↗ |