DPCfam | MC485513
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Residues in low-complexity regions (%) | 2.81 |
| Residues in coiled-coil regions (%) | 0.88 |
| Predicted disordered residues (%) | 17.38 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF01628 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 40.56 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A094PA33 | 84-187 | 104 | LSAAEQRAIGVFLDGASDLDEIMSRTSRVLSQLTKHAAIVQYPSLSKSAVRHIEIVSVTSRKALLVLVTDAGRVEQRTVDCSVDL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5KWZ5-F1 | 84-197 | 100.00 | 88.72 | View in AlphaFoldDB ↗ |