DPCfam | MC485321
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 447 ± 96 aa |
| Residues in low-complexity regions (%) | 8.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.8 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF10254 |
| Sequences matching dominant architecture (%) | 80.0 |
| Average overlap percent | 82.93 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q4REE0 | 634-1177 | 544 | RSTSLKERQPSRPQNERANSLDNERSLDTRCHLQVGGRRCRRRNGQKKAVLNSERVRCVPQIPRKTVYDQLNHILVSDNHLPDSI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3V3Q7-F1 | 403-855 | 99.33 | 74.82 | View in AlphaFoldDB ↗ |