DPCfam | MC485318
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 200 ± 20 aa |
| Residues in low-complexity regions (%) | 4.49 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 6.91 |
| Average transmembrane regions | 2.93 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X2GR61 | 10-219 | 210 | ISPTRIDFPTQRLIATLIFVSLQSYKVYHLVAASLISHSYAYSGLFWKWMLYDCIYIFALYVARIPWLQFSILKSIFLVSLLWSV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O94385-F1 | 12-212 | 99.01 | 77.62 | View in AlphaFoldDB ↗ |