DPCfam | MC485243
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 188 ± 19 aa |
| Residues in low-complexity regions (%) | 9.14 |
| Residues in coiled-coil regions (%) | 12.81 |
| Predicted disordered residues (%) | 52.18 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF14604 |
| Sequences matching dominant architecture (%) | 37.5 |
| Average overlap percent | 10.92 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00064443F9 | 425-600 | 176 | CMQSKVRDLEDKCRSQSEQFGLLSQELEKFRLQASKIDLDSSDLLSHPSLAHLTNGLPGETVDVEAMLRAGSTPHAVGLSRPERS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7TNF8-F1 | 493-696 | 100.00 | 53.24 | View in AlphaFoldDB ↗ |