DPCfam | MC48458
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 462 ± 46 aa |
| Residues in low-complexity regions (%) | 7.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.45 |
| Average transmembrane regions | 8.07 |
| Dominant Pfam architecture(s) | PF03609- PF03613 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 88.75 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1M5WVD8 | 2-505 | 504 | LVSFILITLIAMFGHSEDFLGTTLLSRPLVLGPLVGLVLGDLSQGVVIGATLELIFMGNIKVGAAIPPDVITGGVLSTAFAILSG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GUQ4-F1 | 5-216 | 46.61 | 87.73 | View in AlphaFoldDB ↗ |