DPCfam | MC484512
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3141 |
|---|---|
| Mean domain length (aa) | 276 ± 51 aa |
| Residues in low-complexity regions (%) | 3.23 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 22.49 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01068- PF04679 |
| Sequences matching dominant architecture (%) | 53.72 |
| Average overlap percent | 90.6 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5KHG3 | 319-663 | 345 | WYASRKLDGVRCLSFIDVLVPSSSSKPLEFVHGHFVSRSGKPFHSLTKLSEQLRLLVKDHPDNPLREWLKNDPEVVEIRETGVVK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W1H4-F1 | 391-667 | 95.72 | 91.06 | View in AlphaFoldDB ↗ |