DPCfam | MC484358
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Residues in low-complexity regions (%) | 1.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12561 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 85.68 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J0E7Q7 | 671-775 | 105 | LKDLVPYKQGVKVITLLGLHDPENKLPSYIYPALNGSYGMVYPDDSNKLDTDLDYLEVSLITGRCLQFQLAPIQINRNEMNQFHV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O82882-F1 | 678-782 | 97.27 | 96.22 | View in AlphaFoldDB ↗ |