DPCfam | MC484256
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 265 ± 27 aa |
| Residues in low-complexity regions (%) | 1.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.15 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF14504- PF00188 |
| Sequences matching dominant architecture (%) | 77.14 |
| Average overlap percent | 84.0 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A132MH47 | 148-434 | 287 | RSLWLGLTESDVKRLLGAPDFRGVSRYGAQIWLYSDEPAGPLVVSLKNGQLVDLYTTNPSWESVGVRPQMRLTKAASSFSFQYRQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34586-F1 | 42-323 | 97.92 | 95.07 | View in AlphaFoldDB ↗ |