DPCfam | MC484217
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 123 ± 17 aa |
| Residues in low-complexity regions (%) | 1.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A2QCA5 | 422-530 | 109 | AKKLAQTKKEDQGPNDLVFFFNWLYRKNVRHILKVVVHDTEDAPHTDKAMVDCLSKFEIETLSWRKVDLSSQTLFNACRNLKEVY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2F0H7-F1 | 524-625 | 88.03 | 94.75 | View in AlphaFoldDB ↗ |