DPCfam | MC484103
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2621 |
|---|---|
| Mean domain length (aa) | 173 ± 23 aa |
| Residues in low-complexity regions (%) | 7.21 |
| Residues in coiled-coil regions (%) | 8.66 |
| Predicted disordered residues (%) | 20.82 |
| Average transmembrane regions | 0.47 |
| Dominant Pfam architecture(s) | PF04350 |
| Sequences matching dominant architecture (%) | 52.36 |
| Average overlap percent | 71.84 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F4QE27 | 13-182 | 170 | PKKQRFMLLGVLGAGVVAAYVYLLMMPMWTEKGRLEGELQKLQTDLDQKRIIAANRPKLEAEIKVLEKQLEAVLVKLPEEKEIPK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5FAD0-F1 | 25-171 | 94.81 | 83.76 | View in AlphaFoldDB ↗ |