DPCfam | MC483877
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2351 |
|---|---|
| Mean domain length (aa) | 148 ± 20 aa |
| Residues in low-complexity regions (%) | 5.29 |
| Residues in coiled-coil regions (%) | 3.12 |
| Predicted disordered residues (%) | 23.72 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF12777 |
| Sequences matching dominant architecture (%) | 90.72 |
| Average overlap percent | 47.73 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6Y3Y6 | 3125-3242 | 118 | EALNTLNKTNLTELKSFGAPPLAVTNVTAAVMVLTAPGGKVPKDRSWKAARVVMGKVDGFLDSLITFKKESIHENCIKAIQPYLQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7FP31-F1 | 657-808 | 98.65 | 74.82 | View in AlphaFoldDB ↗ |