DPCfam | MC483758
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 621 |
|---|---|
| Mean domain length (aa) | 160 ± 20 aa |
| Residues in low-complexity regions (%) | 5.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.82 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF13625 |
| Sequences matching dominant architecture (%) | 88.07 |
| Average overlap percent | 73.06 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00083B73E9 | 433-565 | 133 | AWIVQPNFELLVYVDEVAPSQMIFLDRYADRLDIQQHTARYRLTRESVYRGLERGGSLDDFLAALQTGAKVPVPQNVEIDLQQWG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ENU4-F1 | 451-609 | 98.77 | 90.45 | View in AlphaFoldDB ↗ |