DPCfam | MC4837
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 391 |
|---|---|
| Mean domain length (aa) | 189 ± 37 aa |
| Residues in low-complexity regions (%) | 3.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.37 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF09994 |
| Sequences matching dominant architecture (%) | 98.03 |
| Average overlap percent | 10.24 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C5FCF2 | 250-433 | 184 | SEDTTATVKEVWFAGNHSDVGGGFAYENNSRFLLSDIPLAWMLEEAMSVTDGPAGPLTFDDRQPEALNCLKTIEGILQSRAEPNS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NPP7-F1 | 370-571 | 98.87 | 80.08 | View in AlphaFoldDB ↗ |