DPCfam | MC483602
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Residues in low-complexity regions (%) | 0.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00004 |
| Sequences matching dominant architecture (%) | 97.39 |
| Average overlap percent | 53.16 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A088AEY1 | 506-583 | 78 | ISGVPGTGKTATVNEAIRCLQKLILKGQLDDFDYVTINGMKLTEPRQAYVQILKQLYNKTATWEQSYSILEKRFHNTN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QDP7-F1 | 583-657 | 98.68 | 92.06 | View in AlphaFoldDB ↗ |