DPCfam | MC483513
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 62 ± 13 aa |
| Residues in low-complexity regions (%) | 8.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 72.57 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0B2X154 | 1-63 | 63 | MNRSGIPDAWDDDWEAQADRAAVEDDENHQQGGVSLHAAQSLTKAERITQHEEANRKMWESAD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q8G0-F1 | 3-82 | 98.28 | 57.29 | View in AlphaFoldDB ↗ |