DPCfam | MC483406
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 294 ± 27 aa |
| Residues in low-complexity regions (%) | 1.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.06 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11557 |
| Sequences matching dominant architecture (%) | 77.27 |
| Average overlap percent | 90.46 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B4WYX1 | 23-333 | 311 | KASANDAVNRAIRLSLAESFVTANLLTSGDAVRFGFWDFDPNTLLNLDDDNFGSLESRELRQRIATFSLPYTWQTPLAETGNTLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F8B8-F1 | 58-137 | 26.14 | 93.44 | View in AlphaFoldDB ↗ |